SHMT2 antibody, Unconjugated, Rabbit, Polyclonal

Catalog Number: BYT-ORB579686
Article Name: SHMT2 antibody, Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: BYT-ORB579686
Supplier Catalog Number: orb579686
Alternative Catalog Number: BYT-ORB579686-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: IHC, WB
Species Reactivity: Human
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SHMT2
Conjugation: Unconjugated
Alternative Names: GLYA, SHMT, NEDCASB, HEL-S-51e
Rabbit polyclonal antibody to SHMT2
Clonality: Polyclonal
Concentration: 1.0 mg/ml
Molecular Weight: 56kDa
NCBI: 005403
UniProt: P34897
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Form: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence: Synthetic peptide located within the following region: ELIASENFCSRAALEALGSCLNNKYSEGYPGKRYYGGAEVVDEIELLCQR
Target: SHMT2