BCAT1 antibody, Unconjugated, Rabbit, Polyclonal

Catalog Number: BYT-ORB579690
Article Name: BCAT1 antibody, Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: BYT-ORB579690
Supplier Catalog Number: orb579690
Alternative Catalog Number: BYT-ORB579690-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human BCAT1
Conjugation: Unconjugated
Alternative Names: BCT1, PP18, BCATC, ECA39, MECA39, PNAS121
Rabbit polyclonal antibody to BCAT1
Clonality: Polyclonal
Concentration: 0.5 mg/ml
Molecular Weight: 43kDa
NCBI: 005495
UniProt: P54687
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Form: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence: Synthetic peptide located within the following region: MKDCSNGCSAECTGEGGSKEVVGTFKAKDLIVTPATILKEKPDPNNLVFG
Target: BCAT1