STIP1 antibody, Unconjugated, Rabbit, Polyclonal

Catalog Number: BYT-ORB579705
Article Name: STIP1 antibody, Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: BYT-ORB579705
Supplier Catalog Number: orb579705
Alternative Catalog Number: BYT-ORB579705-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: IHC, WB
Species Reactivity: Human
Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human STIP1
Conjugation: Unconjugated
Alternative Names: HOP, P60, STI1, STI1L, HEL-S-94n, IEF-SSP-3521
Rabbit polyclonal antibody to STIP1
Clonality: Polyclonal
Concentration: 1.0 mg/ml
Molecular Weight: 63 kDa
NCBI: 006810
UniProt: P31948
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Form: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence: Synthetic peptide located within the following region: YQKALDLDSSCKEAADGYQRCMMAQYNRHDSPEDVKRRAMADPEVQQIMS
Target: STIP1