MRPL10 antibody, Unconjugated, Rabbit, Polyclonal

Catalog Number: BYT-ORB579707
Article Name: MRPL10 antibody, Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: BYT-ORB579707
Supplier Catalog Number: orb579707
Alternative Catalog Number: BYT-ORB579707-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human MRPL10
Conjugation: Unconjugated
Alternative Names: L10MT, MRPL8, RPML8, MRP-L8, MRP-L10
Rabbit polyclonal antibody to MRPL10
Clonality: Polyclonal
Concentration: 0.5 mg/ml
Molecular Weight: 29kDa
NCBI: 683685
UniProt: Q7Z7H8
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Form: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence: Synthetic peptide located within the following region: HLPGSSDSPASASQVAGITGRLPTLQTVRYGSKAVTRHRRVMHFQRQKLM
Target: MRPL10