PFAS antibody, Unconjugated, Rabbit, Polyclonal

Catalog Number: BYT-ORB579709
Article Name: PFAS antibody, Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: BYT-ORB579709
Supplier Catalog Number: orb579709
Alternative Catalog Number: BYT-ORB579709-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PFAS
Conjugation: Unconjugated
Alternative Names: PURL, FGAMS, GATD8, FGARAT, FGAR-AT
Rabbit polyclonal antibody to PFAS
Clonality: Polyclonal
Concentration: 0.5 mg/ml
Molecular Weight: 145kDa
NCBI: 036525
UniProt: O15067
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Form: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence: Synthetic peptide located within the following region: ESIMSTQESSNPNNVLKFCDNSSAIQGKEVRFLRPEDPTRPSRFQQQQGL
Target: PFAS