NCAPH antibody, Unconjugated, Rabbit, Polyclonal

Catalog Number: BYT-ORB579720
Article Name: NCAPH antibody, Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: BYT-ORB579720
Supplier Catalog Number: orb579720
Alternative Catalog Number: BYT-ORB579720-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human NCAPH
Conjugation: Unconjugated
Alternative Names: CAPH, BRRN1, CAP-H, MCPH23
Rabbit polyclonal antibody to NCAPH
Clonality: Polyclonal
Concentration: 0.5 mg/ml
Molecular Weight: 82kDa
NCBI: 056156
UniProt: Q15003
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Form: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence: Synthetic peptide located within the following region: MPLPRKAPLNIPGTPVLEDFPQNDDEKERLQRRRSRVFDLQFSTDSPRLL
Target: NCAPH