NUSAP1 antibody, Unconjugated, Rabbit, Polyclonal
Catalog Number:
BYT-ORB579729
Article Name: |
NUSAP1 antibody, Unconjugated, Rabbit, Polyclonal |
Biozol Catalog Number: |
BYT-ORB579729 |
Supplier Catalog Number: |
orb579729 |
Alternative Catalog Number: |
BYT-ORB579729-100 |
Manufacturer: |
Biorbyt |
Host: |
Rabbit |
Category: |
Antikörper |
Application: |
WB |
Species Reactivity: |
Human |
Immunogen: |
The immunogen is a synthetic peptide directed towards the middle region of Human NUSAP |
Conjugation: |
Unconjugated |
Alternative Names: |
LNP, ANKT, SAPL, BM037, NUSAP, Q0310, PRO0310p1 |
Rabbit polyclonal antibody to NUSAP1 |
Clonality: |
Polyclonal |
Concentration: |
0.5 mg/ml |
Molecular Weight: |
48kDa |
UniProt: |
Q9BXS6 |
Buffer: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Form: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Sequence: |
Synthetic peptide located within the following region: HFEEHNSMNELKQQPINKGGVRTPVPPRGRLSVASTPISQRRSQGRSCGP |
Target: |
NUSAP1 |