OXSM antibody, Unconjugated, Rabbit, Polyclonal

Catalog Number: BYT-ORB579733
Article Name: OXSM antibody, Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: BYT-ORB579733
Supplier Catalog Number: orb579733
Alternative Catalog Number: BYT-ORB579733-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human OXSM
Conjugation: Unconjugated
Alternative Names: KS, CEM1, KASI, FASN2D
Rabbit polyclonal antibody to OXSM
Clonality: Polyclonal
Concentration: 0.5 mg/ml
Molecular Weight: 49kDa
NCBI: 060367
UniProt: Q9NWU1
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Form: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence: Synthetic peptide located within the following region: HAVQRRARIYAEVLGYGLSGDAGHITAPDPEGEGALRCMAAALKDAGVQP
Target: OXSM