CEP55 antibody, Unconjugated, Rabbit, Polyclonal

Catalog Number: BYT-ORB579735
Article Name: CEP55 antibody, Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: BYT-ORB579735
Supplier Catalog Number: orb579735
Alternative Catalog Number: BYT-ORB579735-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human CEP55
Conjugation: Unconjugated
Alternative Names: CT111, MARCH, URCC6, C10orf3
Rabbit polyclonal antibody to CEP55
Clonality: Polyclonal
Concentration: 0.5 mg/ml
Molecular Weight: 54kDa
NCBI: 060601
UniProt: Q53EZ4
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Form: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence: Synthetic peptide located within the following region: MSSRSTKDLIKSKWGSKPSNSKSETTLEKLKGEIAHLKTSVDEITSGKGK
Target: CEP55