TARS antibody, Unconjugated, Rabbit, Polyclonal

Catalog Number: BYT-ORB579761
Article Name: TARS antibody, Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: BYT-ORB579761
Supplier Catalog Number: orb579761
Alternative Catalog Number: BYT-ORB579761-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: IHC, WB
Species Reactivity: Human
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human TARS
Conjugation: Unconjugated
Alternative Names: TARS, TTD7, ThrRS
Rabbit polyclonal antibody to TARS
Clonality: Polyclonal
Concentration: 1.0 mg/ml
Molecular Weight: 78kDa
NCBI: 88355
UniProt: Q5M7Z9
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Form: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence: Synthetic peptide located within the following region: PEYIYTRLEMYNILKAEHDSILAEKAEKDSKPIKVTLPDGKQVDAESWKT
Target: TARS