ACE2 Rabbit Polyclonal Antibody, Unconjugated
Catalog Number:
BYT-ORB582208
Article Name: |
ACE2 Rabbit Polyclonal Antibody, Unconjugated |
Biozol Catalog Number: |
BYT-ORB582208 |
Supplier Catalog Number: |
orb582208 |
Alternative Catalog Number: |
BYT-ORB582208-100 |
Manufacturer: |
Biorbyt |
Host: |
Rabbit |
Category: |
Antikörper |
Application: |
IHC, WB |
Species Reactivity: |
Human, Rat |
Immunogen: |
The immunogen is a synthetic peptide directed towards the middle region of human ACE2 |
Conjugation: |
Unconjugated |
Alternative Names: |
ACEH |
Rabbit polyclonal antibody to ACE2 |
Clonality: |
Polyclonal |
Concentration: |
0.5 mg/ml |
Molecular Weight: |
89kDa |
NCBI: |
068576 |
Pubmed: |
34152956 |
UniProt: |
Q9BYF1 |
Buffer: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Purity: |
Affinity Purified |
Form: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Sequence: |
Synthetic peptide located within the following region: FVTAPKNVSDIIPRTEVEKAIRMSRSRINDAFRLNDNSLEFLGIQPTLGP |
Target: |
ACE2 |
|
Sample Tissue: Rat Liver, Antibody dilution: 1 ug/ml. |