ANKRD18A antibody, Unconjugated, Rabbit, Polyclonal

Catalog Number: BYT-ORB587266
Article Name: ANKRD18A antibody, Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: BYT-ORB587266
Supplier Catalog Number: orb587266
Alternative Catalog Number: BYT-ORB587266-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human ANKRD18A
Conjugation: Unconjugated
Rabbit polyclonal antibody to ANKRD18A
Clonality: Polyclonal
Concentration: 0.5 mg/ml
Molecular Weight: 23kDa
NCBI: 671728
UniProt: Q8IVF6
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Form: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence: Synthetic peptide located within the following region: VASEEKQERLQRSENKQPQDSQSYGKKKDAMYGNFMLKKDIAMLKEELYA
Target: ANKRD18A