PPTC7 antibody, Unconjugated, Rabbit, Polyclonal

Catalog Number: BYT-ORB587714
Article Name: PPTC7 antibody, Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: BYT-ORB587714
Supplier Catalog Number: orb587714
Alternative Catalog Number: BYT-ORB587714-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human PPTC7
Conjugation: Unconjugated
Alternative Names: TAPP2C, TA-PP2C
Rabbit polyclonal antibody to PPTC7
Clonality: Polyclonal
Concentration: 0.5 mg/ml
Molecular Weight: 32kDa
NCBI: 644812
UniProt: Q8NI37
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Form: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence: Synthetic peptide located within the following region: LVVRGGEVVHRSDEQQHYFNTPFQLSIAPPEAEGVVLSDSPDAADSTSFD
Target: PPTC7