CFI antibody, Unconjugated, Rabbit, Polyclonal

Catalog Number: BYT-ORB587721
Article Name: CFI antibody, Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: BYT-ORB587721
Supplier Catalog Number: orb587721
Alternative Catalog Number: BYT-ORB587721-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human CFI
Conjugation: Unconjugated
Alternative Names: FI, IF, KAF, AHUS3, ARMD13, C3BINA, C3b-INA
Rabbit polyclonal antibody to CFI
Clonality: Polyclonal
Concentration: 0.5 mg/ml
Molecular Weight: 64kDa
NCBI: 000195
UniProt: P05156
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Form: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence: Synthetic peptide located within the following region: AGTYDGSIDACKGDSGGPLVCMDANNVTYVWGVVSWGENCGKPEFPGVYT
Target: CFI