RNF19B antibody, Unconjugated, Rabbit, Polyclonal

Catalog Number: BYT-ORB587739
Article Name: RNF19B antibody, Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: BYT-ORB587739
Supplier Catalog Number: orb587739
Alternative Catalog Number: BYT-ORB587739-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human RNF19B
Conjugation: Unconjugated
Alternative Names: NKLAM, IBRDC3
Rabbit polyclonal antibody to RNF19B
Clonality: Polyclonal
Concentration: 0.5 mg/ml
Molecular Weight: 80kDa
UniProt: Q6ZMZ0
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Form: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence: Synthetic peptide located within the following region: VHAQMAENEEEGSGGGGSEEDPPCRHQSCEQKDCLASKPWDISLAQPESI
Target: RNF19B