TIMM10 antibody, Unconjugated, Rabbit, Polyclonal

Catalog Number: BYT-ORB587773
Article Name: TIMM10 antibody, Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: BYT-ORB587773
Supplier Catalog Number: orb587773
Alternative Catalog Number: BYT-ORB587773-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human TIMM10
Conjugation: Unconjugated
Alternative Names: TIM10, TIM10A, TIMM10A
Rabbit polyclonal antibody to TIMM10
Clonality: Polyclonal
Concentration: 0.5 mg/ml
Molecular Weight: 9kDa
NCBI: 036588
UniProt: P62072
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Form: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence: Synthetic peptide located within the following region: AELSKGESVCLDRCVSKYLDIHERMGKKLTELSMQDEELMKRVQQSSGPA
Target: TIMM10