TTC26 antibody, Unconjugated, Rabbit, Polyclonal

Catalog Number: BYT-ORB587787
Article Name: TTC26 antibody, Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: BYT-ORB587787
Supplier Catalog Number: orb587787
Alternative Catalog Number: BYT-ORB587787-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human TTC26
Conjugation: Unconjugated
Alternative Names: DYF13, IFT56, dyf-13
Rabbit polyclonal antibody to TTC26
Clonality: Polyclonal
Concentration: 0.5 mg/ml
Molecular Weight: 56kDa
NCBI: 079202
UniProt: A0AVF1
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Form: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence: Synthetic peptide located within the following region: LEFKRHVGEEEEDTNLWIGYCAFHLGDYKRALEEYENATKEENCNSEVWV
Target: TTC26