GLIPR1L2 antibody, Unconjugated, Rabbit, Polyclonal
Catalog Number:
BYT-ORB587790
Article Name: |
GLIPR1L2 antibody, Unconjugated, Rabbit, Polyclonal |
Biozol Catalog Number: |
BYT-ORB587790 |
Supplier Catalog Number: |
orb587790 |
Alternative Catalog Number: |
BYT-ORB587790-100 |
Manufacturer: |
Biorbyt |
Host: |
Rabbit |
Category: |
Antikörper |
Application: |
WB |
Species Reactivity: |
Human |
Immunogen: |
The immunogen is a synthetic peptide directed towards the C-terminal region of Human GLIPR1L2 |
Conjugation: |
Unconjugated |
Rabbit polyclonal antibody to GLIPR1L2 |
Clonality: |
Polyclonal |
Concentration: |
0.5 mg/ml |
Molecular Weight: |
26kDa |
NCBI: |
689649 |
UniProt: |
Q4G1C9 |
Buffer: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Form: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Sequence: |
Synthetic peptide located within the following region: IFTPEESEAGNEEEEKEEEKKEKEEMEMEIMEMEEEKEEREEEEEETQKE |
Target: |
GLIPR1L2 |