ZNF735 antibody, Unconjugated, Rabbit, Polyclonal

Catalog Number: BYT-ORB587811
Article Name: ZNF735 antibody, Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: BYT-ORB587811
Supplier Catalog Number: orb587811
Alternative Catalog Number: BYT-ORB587811-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human ZNF735
Conjugation: Unconjugated
Alternative Names: ZNF735P
Rabbit polyclonal antibody to ZNF735
Clonality: Polyclonal
Concentration: 0.5 mg/ml
Molecular Weight: 45kDa
NCBI: 001152996
UniProt: P0CB33
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Form: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence: Synthetic peptide located within the following region: NLFSLGMTVSKPDLIACLEQNKEPQNIKRNEMAAKHPVTCSHFNQDLQPE
Target: ZNF735