CCDC30 antibody, Unconjugated, Rabbit, Polyclonal

Catalog Number: BYT-ORB587824
Article Name: CCDC30 antibody, Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: BYT-ORB587824
Supplier Catalog Number: orb587824
Alternative Catalog Number: BYT-ORB587824-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human CCDC30
Conjugation: Unconjugated
Alternative Names: PFD6L, PFDN6L
Rabbit polyclonal antibody to CCDC30
Clonality: Polyclonal
Concentration: 0.5 mg/ml
Molecular Weight: 62kDa
UniProt: Q5VVM6
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Form: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence: Synthetic peptide located within the following region: GKGLVESFASLQETEEIKSKEAMASSKSPEKSPENLVCSQNSEAGYINVA
Target: CCDC30