FAM155A antibody, Unconjugated, Rabbit, Polyclonal

Catalog Number: BYT-ORB587831
Article Name: FAM155A antibody, Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: BYT-ORB587831
Supplier Catalog Number: orb587831
Alternative Catalog Number: BYT-ORB587831-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human FAM155A
Conjugation: Unconjugated
Alternative Names: NLF-1, FAM155A
Rabbit polyclonal antibody to FAM155A
Clonality: Polyclonal
Concentration: 0.5 mg/ml
Molecular Weight: 50kDa
NCBI: 001073865
UniProt: B1AL88
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Form: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence: Synthetic peptide located within the following region: EGGEMTTCRQCVEAYQDYDHHAQEKYEEFESVLHKYLQSEEYSVKSCPED
Target: FAM155A