FAM189A1 antibody, Unconjugated, Rabbit, Polyclonal

Catalog Number: BYT-ORB587833
Article Name: FAM189A1 antibody, Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: BYT-ORB587833
Supplier Catalog Number: orb587833
Alternative Catalog Number: BYT-ORB587833-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human FAM189A1
Conjugation: Unconjugated
Alternative Names: TMEM228
Rabbit polyclonal antibody to FAM189A1
Clonality: Polyclonal
Concentration: 0.5 mg/ml
Molecular Weight: 37kDa
UniProt: O60320
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Form: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence: Synthetic peptide located within the following region: AQLSPAGDPDTWKTDQRPTPEPFPATSKERPRSLVDSKAYADARVLVAKF
Target: FAM189A1