GPR89A antibody, Unconjugated, Rabbit, Polyclonal

Catalog Number: BYT-ORB587836
Article Name: GPR89A antibody, Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: BYT-ORB587836
Supplier Catalog Number: orb587836
Alternative Catalog Number: BYT-ORB587836-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human GPR89A
Conjugation: Unconjugated
Alternative Names: GPHR, GPR89, SH120, GPR89B, UNQ192
Rabbit polyclonal antibody to GPR89A
Clonality: Polyclonal
Concentration: 0.5 mg/ml
Molecular Weight: 36kDa
UniProt: B7ZAQ6
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Form: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence: Synthetic peptide located within the following region: EYRTIITEVLGELQFNFYHRWFDVIFLVSALSSILFLYLAHKQAPEKQMA
Target: GPR89A