IGLC7 antibody, Unconjugated, Rabbit, Polyclonal

Catalog Number: BYT-ORB587838
Article Name: IGLC7 antibody, Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: BYT-ORB587838
Supplier Catalog Number: orb587838
Alternative Catalog Number: BYT-ORB587838-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human IGLC1
Conjugation: Unconjugated
Rabbit polyclonal antibody to IGLC7
Clonality: Polyclonal
Concentration: 0.5 mg/ml
Molecular Weight: 11kDa
UniProt: A0M8Q6
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Form: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence: Synthetic peptide located within the following region: KAGVETTKPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKT
Target: IGLC7