KLLN antibody, Unconjugated, Rabbit, Polyclonal

Catalog Number: BYT-ORB587840
Article Name: KLLN antibody, Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: BYT-ORB587840
Supplier Catalog Number: orb587840
Alternative Catalog Number: BYT-ORB587840-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human KLLN
Conjugation: Unconjugated
Alternative Names: CWS4, KILLIN
Rabbit polyclonal antibody to KLLN
Clonality: Polyclonal
Concentration: 0.5 mg/ml
Molecular Weight: 19kDa
NCBI: 001119521
UniProt: B2CW77
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Form: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence: Synthetic peptide located within the following region: DSSGGKSSSSFARGALAWCRQRNPNPSCAAAETGARTSLPKERCRGWRLG
Target: KLLN