ZNF90 antibody, Unconjugated, Rabbit, Polyclonal

Catalog Number: BYT-ORB587850
Article Name: ZNF90 antibody, Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: BYT-ORB587850
Supplier Catalog Number: orb587850
Alternative Catalog Number: BYT-ORB587850-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human ZNF90
Conjugation: Unconjugated
Alternative Names: HTF9
Rabbit polyclonal antibody to ZNF90
Clonality: Polyclonal
Concentration: 0.5 mg/ml
Molecular Weight: 66kDa
NCBI: 009069
UniProt: Q03938
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Form: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence: Synthetic peptide located within the following region: CQECDKVFKRSSALSTHKIIHSGEKPYKCEECGKAFKRSSNLTTHKISHT
Target: ZNF90