ZCCHC18 antibody, Unconjugated, Rabbit, Polyclonal
Catalog Number:
BYT-ORB587856
| Article Name: |
ZCCHC18 antibody, Unconjugated, Rabbit, Polyclonal |
| Biozol Catalog Number: |
BYT-ORB587856 |
| Supplier Catalog Number: |
orb587856 |
| Alternative Catalog Number: |
BYT-ORB587856-100 |
| Manufacturer: |
Biorbyt |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
WB |
| Species Reactivity: |
Human |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the C-terminal region of Human ZCCHC18 |
| Conjugation: |
Unconjugated |
| Alternative Names: |
SIZN2, PNMA7B |
| Rabbit polyclonal antibody to ZCCHC18 |
| Clonality: |
Polyclonal |
| Concentration: |
0.5 mg/ml |
| Molecular Weight: |
44kDa |
| NCBI: |
001137450 |
| UniProt: |
P0CG32 |
| Buffer: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Form: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequence: |
Synthetic peptide located within the following region: SGGSGYKNDGPGNIRRARKRKYTTRCSYCGEEGHSKETCDNESNKAQVFE |
| Target: |
ZCCHC18 |
