SCNN1B antibody, Unconjugated, Rabbit, Polyclonal

Catalog Number: BYT-ORB587861
Article Name: SCNN1B antibody, Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: BYT-ORB587861
Supplier Catalog Number: orb587861
Alternative Catalog Number: BYT-ORB587861-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of human SCNN1B
Conjugation: Unconjugated
Alternative Names: BESC1, ENaCb, SCNEB, LIDLS1, ENaCbeta
Rabbit polyclonal antibody to SCNN1B
Clonality: Polyclonal
Concentration: 0.5 mg/ml
Molecular Weight: 66kDa
NCBI: 000327
UniProt: P51168
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Form: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence: Synthetic peptide located within the following region: AKSLRQRRAQASYAGPPPTVAELVEAHTNFGFQPDTAPRSPNTGPYPSEQ
Target: SCNN1B