ALAS1 antibody, Unconjugated, Rabbit, Polyclonal

Catalog Number: BYT-ORB587863
Article Name: ALAS1 antibody, Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: BYT-ORB587863
Supplier Catalog Number: orb587863
Alternative Catalog Number: BYT-ORB587863-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human ALAS1
Conjugation: Unconjugated
Alternative Names: ALAS, MIG4, ALAS3, ALASH, ALAS-H
Rabbit polyclonal antibody to ALAS1
Clonality: Polyclonal
Concentration: 0.5 mg/ml
Molecular Weight: 70kDa
NCBI: 005265002
UniProt: P13196
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Form: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence: Synthetic peptide located within the following region: RALSTAAVHYQQIKETPPASEKDKTAKAKVQQTPDGSQQSPDGTQLPSGH
Target: ALAS1