RHOA antibody, Unconjugated, Rabbit, Polyclonal

Catalog Number: BYT-ORB587866
Article Name: RHOA antibody, Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: BYT-ORB587866
Supplier Catalog Number: orb587866
Alternative Catalog Number: BYT-ORB587866-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Rat
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Rat RHOA
Conjugation: Unconjugated
Alternative Names: Arha, Arha2
Rabbit polyclonal antibody to RHOA
Clonality: Polyclonal
Concentration: 0.5 mg/ml
Molecular Weight: 21 kDa
NCBI: 006243763
UniProt: P61589
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Form: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence: Synthetic peptide located within the following region: AKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQA
Target: RHOA