SCD5 antibody, Unconjugated, Rabbit, Polyclonal

Catalog Number: BYT-ORB587872
Article Name: SCD5 antibody, Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: BYT-ORB587872
Supplier Catalog Number: orb587872
Alternative Catalog Number: BYT-ORB587872-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human SCD5
Conjugation: Unconjugated
Alternative Names: SCD2, SCD4, ACOD4, FADS4, HSCD5, DFNA79
Rabbit polyclonal antibody to SCD5
Clonality: Polyclonal
Concentration: 0.5 mg/ml
Molecular Weight: 28kDa
NCBI: 079182
UniProt: Q86SK9
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Form: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence: Synthetic peptide located within the following region: HRAHHKYSETDADPHNARRGFFFSHIGWLFVRKHRDVIEKGRKLDVTDLL
Target: SCD5