TERT antibody, Unconjugated, Rabbit, Polyclonal

Catalog Number: BYT-ORB587884
Article Name: TERT antibody, Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: BYT-ORB587884
Supplier Catalog Number: orb587884
Alternative Catalog Number: BYT-ORB587884-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human TERT
Conjugation: Unconjugated
Alternative Names: TP2, TRT, CMM9, EST2, TCS1, hTRT, DKCA2, DKCB4, hEST2, PFBMFT1
Rabbit polyclonal antibody to TERT
Clonality: Polyclonal
Concentration: 0.5 mg/ml
Molecular Weight: 88kDa
UniProt: O14746
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Form: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence: Synthetic peptide located within the following region: RQHHAGPPSTSRPPRPWDTPCPPVYAETKHFLYSSGDKEQLRPSFLLSSL
Target: TERT