CASP9 antibody, Unconjugated, Rabbit, Polyclonal

Catalog Number: BYT-ORB587888
Article Name: CASP9 antibody, Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: BYT-ORB587888
Supplier Catalog Number: orb587888
Alternative Catalog Number: BYT-ORB587888-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human CASP9
Conjugation: Unconjugated
Alternative Names: MCH6, APAF3, APAF-3, PPP1R56, ICE-LAP6
Rabbit polyclonal antibody to CASP9
Clonality: Polyclonal
Concentration: 0.5 mg/ml
Molecular Weight: 29kDa
UniProt: P55211
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Form: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence: Synthetic peptide located within the following region: QKDHGFEVASTSPEDESPGSNPEPDATPFQEGLRTFDQLDAISSLPTPSD
Target: CASP9