GSS antibody, Unconjugated, Rabbit, Polyclonal

Catalog Number: BYT-ORB587892
Article Name: GSS antibody, Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: BYT-ORB587892
Supplier Catalog Number: orb587892
Alternative Catalog Number: BYT-ORB587892-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human GSS
Conjugation: Unconjugated
Alternative Names: GSHS, HEL-S-64p, HEL-S-88n
Rabbit polyclonal antibody to GSS
Clonality: Polyclonal
Concentration: 0.5 mg/ml
Molecular Weight: 52kDa
NCBI: 005260463
UniProt: P48637
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Form: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence: Synthetic peptide located within the following region: EEGDQAIAEALAAPSRFVLKPQREGGGNNLYGEEMVQALKQLKDSEERAS
Target: GSS