MALT1 antibody, Unconjugated, Rabbit, Polyclonal

Catalog Number: BYT-ORB587908
Article Name: MALT1 antibody, Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: BYT-ORB587908
Supplier Catalog Number: orb587908
Alternative Catalog Number: BYT-ORB587908-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human MALT1
Conjugation: Unconjugated
Alternative Names: MLT, MLT1, IMD12, PCASP1
Rabbit polyclonal antibody to MALT1
Clonality: Polyclonal
Concentration: 0.5 mg/ml
Molecular Weight: 90kDa
UniProt: Q9UDY8
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Form: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence: Synthetic peptide located within the following region: YWCHVYNDRDSQDSKKVEIIIGRTDEAVECTEDELNNLGHPDNKEQTTDQ
Target: MALT1