MATK antibody, Unconjugated, Rabbit, Polyclonal

Catalog Number: BYT-ORB587909
Article Name: MATK antibody, Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: BYT-ORB587909
Supplier Catalog Number: orb587909
Alternative Catalog Number: BYT-ORB587909-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human MATK
Conjugation: Unconjugated
Alternative Names: CHK, CTK, HYL, Lsk, HYLTK, HHYLTK
Rabbit polyclonal antibody to MATK
Clonality: Polyclonal
Concentration: 0.5 mg/ml
Molecular Weight: 55kDa
NCBI: 647612
UniProt: P42679
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Form: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence: Synthetic peptide located within the following region: SSCWEAEPARRPPFRKLAEKLARELRSAGAPASVSGQDADGSTSPRSQEP
Target: MATK