OAS1 antibody, Unconjugated, Rabbit, Polyclonal

Catalog Number: BYT-ORB587912
Article Name: OAS1 antibody, Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: BYT-ORB587912
Supplier Catalog Number: orb587912
Alternative Catalog Number: BYT-ORB587912-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human OAS1
Conjugation: Unconjugated
Alternative Names: OIAS, IFI-4, OIASI, E18/E16
Rabbit polyclonal antibody to OAS1
Clonality: Polyclonal
Concentration: 0.5 mg/ml
Molecular Weight: 44kDa
NCBI: 058132
UniProt: P00973
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Form: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence: Synthetic peptide located within the following region: AESNSADDETDDPRRYQKYGYIGTHEYPHFSHRPSTLQAASTPQAEEDWT
Target: OAS1