MTAP antibody, Unconjugated, Rabbit, Polyclonal

Catalog Number: BYT-ORB587920
Article Name: MTAP antibody, Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: BYT-ORB587920
Supplier Catalog Number: orb587920
Alternative Catalog Number: BYT-ORB587920-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human MTAP
Conjugation: Unconjugated
Alternative Names: BDMF, MSAP, DMSFH, LGMBF, DMSMFH, c86fus, HEL-249
Rabbit polyclonal antibody to MTAP
Clonality: Polyclonal
Concentration: 0.5 mg/ml
Molecular Weight: 38kDa
UniProt: Q13126
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Form: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence: Synthetic peptide located within the following region: FIDRTTMRPQSFYDGSHSCARGVCHIPMAEPFCPKTREVLIETAKKLGLR
Target: MTAP