Human TMPRSS2 protein

Catalog Number: BYT-ORB705030
Article Name: Human TMPRSS2 protein
Biozol Catalog Number: BYT-ORB705030
Supplier Catalog Number: orb705030
Alternative Catalog Number: BYT-ORB705030-20,BYT-ORB705030-100
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Serine protease 10
Recombinant Human Transmembrane protease serine 2(TMPRSS2),partial
Molecular Weight: 46.9 kDa
UniProt: O15393
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Homo sapiens (Human)
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: WKFMGSKCSNSGIECDSSGTCINPSNWCDGVSHCPGGEDENRCVRLYGPNFILQVYSSQRKSWHPVCQDDWNENYGRAACRDMGYKNNFYSSQGIVDDSGSTSFMKLNTSAGNVDIYKKLYHSDACSSKAVVSLRCIACGVNLNSSRQSRIVGGESALPGAWPWQVSLHVQNVHVCGGSIITPEWIVTAAHCVEKPLNNPWHWTAFAGILRQSFMFYGAGYQVEKVISHPNYDSKTKNNDIALMKLQKPLTFND
Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration