Monkey ACE2 protein

Product Overview

• Article Name: Monkey ACE2 protein
• Biozol Catalog Number: BYT-ORB705341
• Supplier Catalog Number: orb705341
• Alternative Catalog Number: BYT-ORB705341-20,BYT-ORB705341-100,BYT-ORB705341-1
• Manufacturer: Biorbyt
• Category: Proteine/Peptide

Product Description

Recombinant Macaca fascicularis Angiotensin-converting enzyme(ACE2),partial

Product Properties

• Molecular Weight: 112.7 kDa
• UniProt: A0A2K5X283
• Buffer: Lyophilized from a 0.2 µm filtered PBS, 6% Trehalose, pH 7.4
• Source: Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)
• Purity: Greater than 93% as determined by SDS-PAGE.
• Form: Lyophilized powder
• Sequence: QSTIEEQAKTFLDKFNHEAEDLFYQSSLASWNYNTNITEENVQNMNNAGEKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQQNGSSVLSEDKSKRLNTILNTMSTIYSTGKVCNPNNPQECLLLDPGLNEIMEKSLDYNERLWAWEGWRSEVGKQLRPLYEEYVVLKNEMARANHYKDYGDYWRGNYEVNGVDGYDYNRDQLIEDVERTFEEIKPLYEHLHAYVRAKLMNAYPSYISPTGCLPAHLLGDMW

Application Notes

• Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration