Human ACE2 protein

Product Overview

• Article Name: Human ACE2 protein
• Biozol Catalog Number: BYT-ORB705345
• Supplier Catalog Number: orb705345
• Alternative Catalog Number: BYT-ORB705345-20,BYT-ORB705345-100,BYT-ORB705345-500,BYT-ORB705345-1
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Alternative Names: /

Product Description

Recombinant Human Angiotensin-converting enzyme 2(ACE2),partial

Product Properties

• Molecular Weight: 112.6kDa
• UniProt: Q9BYF1
• Buffer: Lyophilized from a 0.2 µm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0
• Source: Homo sapiens (Human)
• Purity: Greater than 90% as determined by SDS-PAGE.
• Form: Lyophilized powder
• Sequence: QSTIEEQAKTFLDKFNHEAEDLFYQSSLASWNYNTNITEENVQNMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQQNGSSVLSEDKSKRLNTILNTMSTIYSTGKVCNPDNPQECLLLEPGLNEIMANSLDYNERLWAWESWRSEVGKQLRPLYEEYVVLKNEMARANHYEDYGDYWRGDYEVNGVDGYDYSRGQLIEDVEHTFEEIKPLYEHLHAYVRAKLMNAYPSYISPIGCLPAHLLGDMW

Application Notes

• Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration