SARS-CoV-2 NSP3 Antibody, Unconjugated, Rabbit, Polyclonal

Catalog Number: BYT-ORB738429
Article Name: SARS-CoV-2 NSP3 Antibody, Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: BYT-ORB738429
Supplier Catalog Number: orb738429
Alternative Catalog Number: BYT-ORB738429-10,BYT-ORB738429-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: ELISA
Species Reactivity: Human
Immunogen: HSLSHFVNLDNLRANNTKGSLPINVIVFDGKSKCEESSAKSASVYYSQLMCQPILLLDQALVSDVGDSAEVAVKMFDAYVNTFSSTFNVPMEKLKTLVATAEAELAKNVSLDNVLSTFISAARQGFVDSDVETKDVVECLKLSHQSDIEVTGDSCNNYMLTYNKVENMTPRDLGACIDCSARHINAQVAKSHNIALIWNVKDFMSLSEQLRKQIRSAAKKNNLPFKLTCATTRQVVNVVTTKIALK
Conjugation: Unconjugated
Alternative Names: Replicase polyprotein 1ab, pp1ab, ORF1ab polyprotein, nsp3, Non-structural protein 3, PL2-PRO, Papain-like proteinase, PL-PRO, sars-cov-2
SARS-CoV-2 NSP3 Antibody
Clonality: Polyclonal
Concentration: Adding 0.2 ml of distilled water will yield a concentration of 500 µg/ml.
Molecular Weight: 140 kDa, 130 kDa, 110 kDa
Sensitivity: > 5000 cells
Pubmed: 38150587
UniProt: P0DTC1
Buffer: Lyophilized
Form: Lyophilized
Application Notes: Tested Species: In-house tested species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users. Add 0.2ml of distilled water will yield a concentration of 500ug/ml.