SARS-CoV-2 NSP9 Antibody, Unconjugated, Rabbit, Polyclonal

Product Overview

• Article Name: SARS-CoV-2 NSP9 Antibody, Unconjugated, Rabbit, Polyclonal
• Biozol Catalog Number: BYT-ORB738433
• Supplier Catalog Number: orb738433
• Alternative Catalog Number: BYT-ORB738433-10,BYT-ORB738433-100
• Manufacturer: Biorbyt
• Host: Rabbit
• Category: Antikörper
• Application: ELISA
• Species Reactivity: Human
• Immunogen: NNELSPVALRQMSCAAGTTQTACTDDNALAYYNTTKGGRFVLALLSDLQDLKWARFPKSDGTGTIYTELEPPCRFVTDTPKGPKVKYLYFIKGLNNLNRGMVLGSLAATVRLQ
• Conjugation: Unconjugated
• Alternative Names: Replicase polyprotein 1ab, pp1ab, ORF1ab polyprotein, nsp9, Non-structural protein 9, sars-cov-2

Product Description

SARS-CoV-2 NSP9 Antibody

Product Properties

• Clonality: Polyclonal
• Concentration: Adding 0.2 ml of distilled water will yield a concentration of 500 µg/ml.
• Molecular Weight: 140 kDa, 130 kDa, 110 kDa
• Sensitivity: > 5000 cells
• UniProt: P0DTC1
• Buffer: Lyophilized
• Form: Lyophilized

Application Notes

• Application Notes: Tested Species: In-house tested species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users. Add 0.2ml of distilled water will yield a concentration of 500ug/ml.