Human CCR8 protein

Catalog Number: BYT-ORB865263
Article Name: Human CCR8 protein
Biozol Catalog Number: BYT-ORB865263
Supplier Catalog Number: orb865263
Alternative Catalog Number: BYT-ORB865263-20,BYT-ORB865263-100,BYT-ORB865263-500,BYT-ORB865263-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: (CC chemokine receptor CHEMR1) (CMKBRL2) (Chemokine receptor-like 1) (CKR-L1) (GPR-CY6) (GPRCY6) (TER1) (CDw198) (CKRL1) (CMKBR8) (CMKBRL2)
Recombinant Human C-C chemokine receptor type 8(CCR8)-VLPs (Active)
Molecular Weight: 42.2 kDa
UniProt: P51685
Buffer: Lyophilized from a 0.2 µm filtered PBS, 6% Trehalose, pH 7.4
Source: Homo sapiens (Human)
Purity: Testing in progress.
Form: Lyophilized powder
Sequence: MDYTLDLSVTTVTDYYYPDIFSSPCDAELIQTNGKLLLAVFYCLLFVFSLLGNSLVILVLVVCKKLRSITDVYLLNLALSDLLFVFSFPFQTYYLLDQWVFGTVMCKVVSGFYYIGFYSSMFFITLMSVDRYLAVVHAVYALKVRTIRMGTTLCLAVWLTAIMATIPLLVFYQVASEDGVLQCYSFYNQQTLKWKIFTNFKMNILGLLIPFTIFMFCYIKILHQLKRCQNHNKTKAIRLVLIVVIASLLFWVPF
Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL.Aliquot for long-term storage at -80°C. Solubilize for 60 mi