Recombinant Human Neutrophil gelatinase-associated lipocalin protein(LCN2) (Active)
Catalog Number:
CSB-AP000461HU
- Images (0)
| Article Name: | Recombinant Human Neutrophil gelatinase-associated lipocalin protein(LCN2) (Active) |
| Biozol Catalog Number: | CSB-AP000461HU |
| Supplier Catalog Number: | CSB-AP000461HU |
| Alternative Catalog Number: | CSB-AP000461HU-500, CSB-AP000461HU-100, CSB-AP000461HU-10 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | NGAL, Lipocalin-2, Oncogene 24p3, Siderocalin LCN2, p25 |
| Molecular Weight: | 20.5 kDa |
| Tag: | Tag-Free |
| UniProt: | P80188 |
| Buffer: | Lyophilized from a 0.2 µm filtered PBS, pH 7.4, with 0.05 % Tween-20 |
| Source: | E.Coli |
| Expression System: | 21-198aa |
| Purity: | >95% as determined by SDS-PAGE and HPLC. |
| Form: | Lyophilized powder |
| Sequence: | QDSTSDLIPAPPLSKVPLQQNFQDNQFQGKWYVVGLAGNAILREDKDPQKMYATIYELKEDKSYNVTSVLFRKKKCDYWIRTFVPGCQPGEFTLGNIKSYPGLTSYLVRVVSTNYNQHAMVFFKKVSQNREYFKITLYGRTKELTSELKENFIRFSKSLGLPENHIVFPVPIDQCIDG |
Product Guarantee and Expert Support
