Recombinant Mouse Fatty acid-binding protein, liver protein(Fabp1) (Active)
Catalog Number:
CSB-AP000551MO
- Images (0)
| Article Name: | Recombinant Mouse Fatty acid-binding protein, liver protein(Fabp1) (Active) |
| Biozol Catalog Number: | CSB-AP000551MO |
| Supplier Catalog Number: | CSB-AP000551MO |
| Alternative Catalog Number: | CSB-AP000551MO-500, CSB-AP000551MO-100, CSB-AP000551MO-5 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | 14 kDa selenium-binding protein, Liver-type fatty acid-binding protein, L-FABP |
| Molecular Weight: | 14.2 kDa |
| Tag: | Tag-Free |
| UniProt: | P12710 |
| Buffer: | Lyophilized from a 0.2 µm filtered concentrated solution in PBS, pH 7.4, 2 % trehalose. |
| Source: | E.Coli |
| Expression System: | 1-127aa |
| Purity: | >95% as determined by SDS-PAGE and HPLC. |
| Form: | Lyophilized powder |
| Sequence: | MNFSGKYQLQSQENFEPFMKAIGLPEDLIQKGKDIKGVSEIVHEGKKIKLTITYGPKVVRNEFTLGEECELETMTGEKVKAVVKLEGDNKMVTTFKGIKSVTELNGDTITNTMTLGDIVYKRVSKRI |
Product Guarantee and Expert Support
