Recombinant Human C-X-C motif chemokine 5 (CXCL5), partial (Active)
Catalog Number:
CSB-AP000671HU
- Images (0)
| Article Name: | Recombinant Human C-X-C motif chemokine 5 (CXCL5), partial (Active) |
| Biozol Catalog Number: | CSB-AP000671HU |
| Supplier Catalog Number: | CSB-AP000671HU |
| Alternative Catalog Number: | CSB-AP000671HU-500, CSB-AP000671HU-100, CSB-AP000671HU-5 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | ENA-78, Epithelial-derived neutrophil-activating protein 78, Neutrophil-activating peptide ENA-78, Small-inducible cytokine B5, |
| Molecular Weight: | 7.8 kDa |
| Tag: | Tag-Free |
| UniProt: | P42830 |
| Buffer: | Lyophilized from a 0.2 µm filtered 2 * PBS, pH 7.4 |
| Source: | E.Coli |
| Expression System: | 44-114aa |
| Purity: | >95% as determined by SDS-PAGE and HPLC. |
| Form: | Lyophilized powder |
| Sequence: | LRELRCVCLQTTQGVHPKMISNLQVFAIGPQCSKVEVVASLKNGKEICLDPEAPFLKKVIQKILDGGNKEN |
Product Guarantee and Expert Support
