Recombinant Human C-X-C motif chemokine 6 protein(CXCL6), partial (Active)
Catalog Number:
CSB-AP000691HU
- Images (0)
| Article Name: | Recombinant Human C-X-C motif chemokine 6 protein(CXCL6), partial (Active) |
| Biozol Catalog Number: | CSB-AP000691HU |
| Supplier Catalog Number: | CSB-AP000691HU |
| Alternative Catalog Number: | CSB-AP000691HU-500, CSB-AP000691HU-100, CSB-AP000691HU-5 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | Chemokine alpha 3, Granulocyte chemotactic protein 2, GCP-2, Small-inducible cytokine B6, |
| Molecular Weight: | 7.9 kDa |
| Tag: | Tag-Free |
| UniProt: | P80162 |
| Buffer: | Lyophilized from a 0.2 µm filtered PBS, pH 7.4 |
| Source: | E.Coli |
| Expression System: | 43-114aa |
| Purity: | >98% as determined by SDS-PAGE and HPLC. |
| Form: | Lyophilized powder |
| Sequence: | VLTELRCTCLRVTLRVNPKTIGKLQVFPAGPQCSKVEVVASLKNGKQVCLDPEAPFLKKVIQKILDSGNKKN |
Product Guarantee and Expert Support
