Recombinant Human C-X-C motif chemokine 9 protein(CXCL9) (Active)
Catalog Number:
CSB-AP000711HU
- Images (0)
| Article Name: | Recombinant Human C-X-C motif chemokine 9 protein(CXCL9) (Active) |
| Biozol Catalog Number: | CSB-AP000711HU |
| Supplier Catalog Number: | CSB-AP000711HU |
| Alternative Catalog Number: | CSB-AP000711HU-500, CSB-AP000711HU-100, CSB-AP000711HU-5 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | Gamma-interferon-induced monokine, HuMIG, MIG, Small-inducible cytokine B9, |
| Molecular Weight: | 11.7 kDa |
| Tag: | Tag-Free |
| UniProt: | Q07325 |
| Buffer: | Lyophilized from a 0.2 µm filtered concentrated solution in 20 mM PB, pH 7.4, 50 mM NaCl. |
| Source: | E.Coli |
| Expression System: | 23-125aa |
| Purity: | >97% as determined by SDS-PAGE and HPLC. |
| Form: | Lyophilized powder |
| Sequence: | TPVVRKGRCSCISTNQGTIHLQSLKDLKQFAPSPSCEKIEIIATLKNGVQTCLNPDSADVKELIKKWEKQVSQKKKQKNGKKHQKKKVLKVRKSQRSRQKKTT |
Product Guarantee and Expert Support
