Recombinant Human Stromal cell-derived factor 1 protein(CXCL12) (Active)
Catalog Number:
CSB-AP000751HU
- Images (0)
| Article Name: | Recombinant Human Stromal cell-derived factor 1 protein(CXCL12) (Active) |
| Biozol Catalog Number: | CSB-AP000751HU |
| Supplier Catalog Number: | CSB-AP000751HU |
| Alternative Catalog Number: | CSB-AP000751HU-500, CSB-AP000751HU-100, CSB-AP000751HU-10 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | SDF-1, C-X-C motif chemokine 12, Intercrine reduced in hepatomas, IRH, hIRH |
| Molecular Weight: | 8.5 kDa |
| Tag: | Tag-Free |
| UniProt: | P48061 |
| Buffer: | Lyophilized from a 0.2 µm filtered PBS, pH 7.4 |
| Source: | E.Coli |
| Expression System: | 22-93aa |
| Purity: | >97% as determined by SDS-PAGE and HPLC. |
| Form: | Lyophilized powder |
| Sequence: | KPVSLSYRCPCRFFESHVARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNKRFKM |
Product Guarantee and Expert Support
